Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-1Ra Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-1Ra, ICIL-1RA, IRAP, IL-1RN, Interleukin-1Ra
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10001RA020 20 µg
RBG10001RA100 100 μg
RBG10001RA250 250 µg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Interleukin-1 receptor antagonist (IL-1RA) is a naturally-occurring, inflammatory-inhibitor protein. It inhibits the activity of IL-1α and IL-1β by competitively blocking their binding to type I and type II receptors. IL-1RA is produced by corneal epithelial cells, monocytes, neutrophils, macrophages, and fibroblasts. Therapeutically, IL-1RA may help in the treatment of sepsis, cachexia, rheumatoid arthritis, chronic myelogenous leukemia, asthma, psoriasis, and inflammatory bowel disease. Recombinant Human IL-1RA is a 17.2 kDa protein consisting of 153 amino acid residues.

Amino Acid Sequence

MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to inhibit the IL-1α stimulation of murine D10S cell. The expected ED 50 is 20–40 ng/ml in the presence of 50 pg/ml of IL-1α.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1– 1.0mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers

Related Products Docs