Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-23 Human (BTI-Tn-5B1-4) Hi-5 Insect cells*

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:(BTI-Tn-5B1-4) Hi-5 Insect cells*
  • Other names:IL-23, IL-23P19, IL-23A, JKA3 induced upon T cell activation, SGRF, IL-23 p40, CLMF p40, CLMF 2, Cytotoxic lymphocyte maturation factor 2, NK cell stimulatory factor chain 2, T-cell stimulating factor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10023002 2 µg
RBG10023010 10 µg
RBG10023100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-23 is a proinflammatory, heterodimeric protein composed of two subunits: a unique p19 subunit, and a p40 subunit that is shared with IL-12. IL-23 is secreted by activated dendritic cells and macrophages, and signals though a receptor comprised of IL-23R complexed with IL-12Rβ2. IL-23 has been shown to enhance proliferation of memory T cells. It also stimulates the production of IFN-γ in NK cells, induces IL-17 production, and drives Th17-mediated responses. Recombinant Human IL-23 is a 53.5 kDa, heterodimeric protein consisting of the two subunits, p19 (170 amino acids) and p40 (306 amino acids).

Amino Acid Sequence

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Source

(BTI-Tn-5B1-4) Hi-5 Insect cells*

Purity

95%

Biological Activity

Measured by its ability to induce IL-17 secretion by mouse splenocytes.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Summary

IL-23 is a heterodimeric cytokine composed of the p40 subunit of IL-12 disulfide-linked with a protein p19. p19, like p35 of IL-12, is biologically inactive by itself. IL-23 interacts with IL-12Rbeta1 and an additional, novel beta2-like receptor subunit with STAT4 binding domain, termed IL-23R. IL-23 is secreted by activated mouse and Human dendritic cells. Biological activities of mouse IL-23 are distinct from those of mouse IL-12. Mouse IL-23 was found not to induce significant amounts of IFN-γ. Mouse IL-23 does induce strong proliferation of memory T cells (but not naïve T cells), whereas IL-12 has no effect on memory cells. Additionally, mouse IL-23 (but not IL-12) can activate mouse memory T cells to produce the proinflammatory cytokine IL-17. Human IL-23 has biological properties which are less distinct from Human IL-12; Human IL-23 induces proliferation of memory T cells and induces moderate levels of IFN-γ production by naïve and memory T cells, as compared to IL-12. The recombinant protein used as standard in this kit is produced in baculovirus-infected insect cells as an authentic heterodimer of precursor p19 and p40 subunits using a dual promoter expression system. It is distinct from other available forms of the protein in that it is expressed as a true heterodimer, as opposed to a single-chain, pseudo-heterodimer in which the subunits are joined by an artificial linker.

Related Products Docs