Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-24 Human Chinese Hamster Ovary Cells (CHO)

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Chinese Hamster Ovary Cells (CHO)
  • Other names:MDA-7 (Melanoma differentiation-association gene 7 protein)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10024005 5 µg
RBG10024020 20 µg
RBG10024100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-24 is a secreted glycoprotein belonging to the IL-10 structural family of cytokines. It is produced by a variety of cell types, including B cells, CD4+ cells, NK cells, lymph node DCs, monocytes, and melanoma cells. IL-24 can signal through the IL20R1/IL20R2 and IL22R1/IL20R2 receptors to initiate a signaling cascade, which includes the induction of JAK1/STAT3 phosphorylation. IL-24 is, functionally, a pleiotropic protein, but is generally characterized as an anti-cancer cytokine that can selectively inhibit growth of a wide variety of human cancer cells through activities that include: the induction of differentiation and apoptosis; and the suppression of angiogenesis and cell proliferation. Recombinant Human IL-24 is an 18.9 kDa glycoprotein that contains 161 amino acid residues, including a C-terminal His-tag.

Amino Acid Sequence

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKLHHHHHH

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

Data not available.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Apoptosis, Cardiovascular disease, Coronary artery disease, Oncology

Related Products Docs