Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:MCGF (Mast cell growth factor), Multi-CSF, P-cell stimulation factor
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10003002 2 µg
RBG10003010 10 µg
RBG10003100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoiesis, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is a species-specific, variably glycosylated cytokine. Recombinant Human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.

Amino Acid Sequence

APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Source

E. coli

Purity

98%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1×10units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Immune Response, Infection and Inflammation, Oncology

Related Products Docs