Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-33 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-33, DVS27-related protein, IL1F11
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20033002 2 µg
RBG20033010 10 µg
RBG20033100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-κB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Murine IL-33 is a 17.5 kDa protein containing 158 amino acid residues.

Amino Acid Sequence

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤ 0.5 ng/ml, corresponding to a specific activity of ≥ 2×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Cytokines and chemokines and related molecules, Energy metabolism and body weight regulation, Oncology, Animal studies

Related Products Docs