Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-36β Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-1F8 , IL-1H2, IL-1 eta
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10036B002 2 µg
RBG10036B010 10 µg
RBG10036B100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The IL-1 family is comprised of 11 structurally related ligands, including recently re-named IL-36α (IL-1F6), β (IL-1F8) and γ (IL-1F9). IL-36β is highly expressed in psoriatic plaques, and at lower levels in various other tissues. IL-36β signals through the IL-1Rrp2 (IL-1R6) receptor, which is primarily expressed on certain dendritic cells. The interaction of the IL-1Rrp2 receptor with IL-36 ligands induces dendritic cell maturation and activation. IL-36β also functions as an agonist of NF-κB, and stimulates the production of pro-inflammatory proteins, including IL-6, IL-8, BD-2, and BD-3. Recombinant Human IL-36β is a 17.3 kDa protein containing 154 amino acid residues.

Amino Acid Sequence

MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Source

E. coli

Purity

98%

Biological Activity

Measured by its ability to induce IL-8 production by human PBMCs.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology

Related Products Docs