Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-36γ Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-1F, IL-1ε (epsilon), IL-1H1, Il36 gamma, Il-36 gamma, Il 36 gamma
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10036G002 2 µg
RBG10036G010 10 µg
RBG10036G100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The IL-1 family is comprised of 11 structurally related ligands, including recently re-named IL-36 α (IL-1F6), β (IL-1F8) and γ (IL-1F9). IL-36γ is highly expressed in psoriatic plaques and in tissues containing epithelial cells. IL-36γ signals through the IL-1Rrp2 (IL-1R6) receptor, which is primarily expressed on certain dendritic cells. The interaction of the IL-1Rrp2 receptor with IL-36 ligands induces dendritic cell maturation and activation. IL-36γ also functions as an agonist of NF-κB, and can stimulate the inflammatory response in bronchial epithelial cells. Recombinant Human IL-36γ is a 17.0 kDa protein containing 152 amino acid residues.

Amino Acid Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Source

E. coli

Purity

95%

Biological Activity

Measured by its ability to induce IL-8 production by human PBMCs.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology

Summary

IL-36α (IL-1F6), IL-36β (IL-1F8) and IL-36γ (IL-1F9) are members of the IL-1 cytokine family that bind to IL-36R (IL-1Rrp2) and IL-1RAcP, activating similar intracellular signals as IL-1 and are inhibited by IL-36Ra (1). The expression of IL-36 cytokines occurs mainly in the lung and skin and can be derived from diverse epithelial cell types including keratinocytes, bronchial epithelium as well as macrophages, monocytes and different T cell subsets. IL-36γ expression is significantly induced upon TLR stimulation and induced in bronchial epithelium exposed to inflammatory stimuli suggesting that these proteins are involved in first-line defences against microorganisms (1,2). IL-36 family members induce the production of pro-inflammatory cytokines, including IL-12, IL-1β, IL-6, TNF-α and IL-23, thus promoting neutrophil influx, dendritic cell (DC) activation, polarization of T helper type 1 (Th1) and IL-17-producing T cells (αβ T cells and γδ T cells) and keratinocyte proliferation (1). The IL-36 cytokines may represent potential targets for immune-mediated inflammatory conditions or, alternatively, could be used as adjuvants in vaccination. Induction of IL-36γ in macrophages upon M. tuberculosis infection and its role in the release of antimicrobial peptides has been proposed (2). IL-36γ is also induced in the lung in various models of asthma and can be produced by bronchial epithelial cells in response to viral infection, smoke or inflammatory cytokines and plays an important role in asthmatic pulmonary inflammation (3). IL-36γ might be a potential biomarker of Inflammatory Bowel Disease (4,5), and is highly expressed in inflamed skin from psoriasis patients and in Allergic Contact Dermatitis (6). IL-36γ serum levels are enhanced and correlate to psoriasis severity and response to treatment with anti-TNF (7).

Summary References (7)

References to Interleukin-36 gamma

  • Ahsan F, Moura-Alves P, Guhlich-Bornhof U, Klemm M, Kaufmann SH, Maertzdorf J.Role of Interleukin 36γ in Host Defense Against Tuberculosis. J Infect Dis. 2016 Aug 1;214(3):464-74. doi: 10.1093/infdis/jiw152. Epub 2016 Apr 18. PubMed PMID:27389350. See more on PubMed
  • Balato A, Mattii M, Caiazzo G, Raimondo A, Patruno C, Balato N, Ayala F, LemboS. IL-36γ Is Involved in Psoriasis and Allergic Contact Dermatitis. J InvestDermatol. 2016 Jul;136(7):1520-1523. doi: 10.1016/j.jid.2016.03.020. Epub 2016Mar 26. PubMed PMID: 27021407. See more on PubMed
  • Bochkov YA, Hanson KM, Keles S, Brockman-Schneider RA, Jarjour NN, Gern JE.Rhinovirus-induced modulation of gene expression in bronchial epithelial cellsfrom subjects with asthma. Mucosal Immunol. 2010 Jan;3(1):69-80. doi:10.1038/mi.2009.109. Epub 2009 Aug 26. PubMed PMID: 19710636; PubMed CentralPMCID: PMC2884103. See more on PubMed
  • D'Erme AM, Wilsmann-Theis D, Wagenpfeil J, Hölzel M, Ferring-Schmitt S,Sternberg S, Wittmann M, Peters B, Bosio A, Bieber T, Wenzel J. IL-36γ (IL-1F9)is a biomarker for psoriasis skin lesions. J Invest Dermatol. 2015Apr;135(4):1025-1032. doi: 10.1038/jid.2014.532. Epub 2014 Dec 19. PubMed PMID:25525775. See more on PubMed
  • Medina-Contreras O, Harusato A, Nishio H, Flannigan KL, Ngo V, Leoni G,Neumann PA, Geem D, Lili LN, Ramadas RA, Chassaing B, Gewirtz AT, Kohlmeier JE,Parkos CA, Towne JE, Nusrat A, Denning TL. Cutting Edge: IL-36 Receptor Promotes Resolution of Intestinal Damage. J Immunol. 2016 Jan 1;196(1):34-8. doi:10.4049/jimmunol.1501312. Epub 2015 Nov 20. PubMed PMID: 26590314; PubMed CentralPMCID: PMC4684965. See more on PubMed
  • Nishida A, Hidaka K, Kanda T, Imaeda H, Shioya M, Inatomi O, Bamba S, Kitoh K,Sugimoto M, Andoh A. Increased Expression of Interleukin-36, a Member of theInterleukin-1 Cytokine Family, in Inflammatory Bowel Disease. Inflamm Bowel Dis. 2016 Feb;22(2):303-14. doi: 10.1097/MIB.0000000000000654. PubMed PMID: 26752465. See more on PubMed
  • Walsh PT, Fallon PG. The emergence of the IL-36 cytokine family as noveltargets for inflammatory diseases. Ann N Y Acad Sci. 2018 Apr;1417(1):23-34. doi:10.1111/nyas.13280. Epub 2016 Oct 26. Review. PubMed PMID: 27783881. See more on PubMed
Related Products Docs