Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-36RA Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1, delta
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10036RA005 5 µg
RBG10036RA025 25 µg
RBG10036RA100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-κB signaling induced by either IL-36α, β or γ by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant Human IL-36RA is an E. coli-derived 17 kDa protein containing 154 amino acid residues.

Amino Acid Sequence

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD

Source

E. coli

Purity

98%

Biological Activity

Measured by its ability to inhibit IL-36ɣ; induced IL-6 production by human PBMCs.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology

Related Products Docs