Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Insulin Like Growth Factor- II Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IGF-II
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10187010 10 µg
RBG10187050 50 µg
RBG10187100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Amino Acid Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by a cell proliferation assay using FDC-P1 cells is 2.0 ng/ml, corresponding to a specific activity of 5×105 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Related Products Docs