Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-10 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-10, Cytokine synthesis inhibitory factor, B cell derived T cell growth factor, Mast cell growth factor III), Insulin receptor substrate (IRS)
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20010002 2 µg
RBG20010010 10 µg
RBG20010100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-10 is an immunosuppressive cytokine produced by a variety of mammalian cell types including macrophages, monocytes, T cells, B cells and keratinocytes. IL-10 inhibits the expression of proinflammatory cytokines such as IL-1 and TNF-α. Like IL-4, IL-10 enhances humoral immune responses and attenuates cell-mediated immune reactions. Human IL-10 is active on murine cells, but murine IL-10 is inactive on human cells. Recombinant Murine IL-10 is an 18.7 kDa protein of 161 amino acid residues.

Amino Acid Sequence

MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGQKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLEDQGVYKAMNEFDIFINCIEAYMMIKMKS

Source

E. coli

Purity

98%

Biological Activity

PeproTech's Murine IL-10 is fully biologically active as measured by the dose-dependent co-stimulation (with IL-4) of the proliferation of murine MC/9 cells. The ED50 was found to be < 2 ng/ml, corresponding to a specific activity of > 5×105 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Summary

IL-10 is an immunoregulatory protein produced by a number of cell lineages, including TH2 cells, B-cells and activated monocytes. Il-10 is an important factor in understanding autoimmunity and as a target molecule in the development of anti-rejection therapies.

Related Products Docs