Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-11 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-11
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10011002 2 µg
RBG10011010 10 µg
RBG10011100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-11 is a multifunctional cytokine produced by stromal cells, such as fibroblasts, epithelial cells and osteoclasts. It is expressed in a wide variety of tissues, including thymus, lung, bone, connective tissue and central nervous system. IL-11 plays an important regulatory role in hematopoiesis by stimulating growth of myeloid, erythroid and megakaryocyte progenitor cells. It also regulates bone metabolism, inhibits production of proinflammatory cytokines, and protects against gastromucosal injury. Recombinant Human IL-11 is a 19.3 kDa protein consisting of 179 amino acid residues.

Amino Acid Sequence

MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Source

E. coli

Purity

98%

Biological Activity

The ED 50 was determined by the dose-dependent stimulation of the proliferation of murine T11 cells is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5×10 5 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Please Note: This solution is slow to dissolve. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Related Products Docs