Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-13 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-13, ALRH
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20013002 2 µg
RBG20013010 10 µg
RBG20013100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 are cross-species reactive. Recombinant Murine IL-13 is a 12.3 kDa protein consisting of 111 amino acid residues.

Amino Acid Sequence

MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent proliferation of TF-1 cells was 4.0 ng/ml, corresponding to a specific activity of 2.5×105 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Note: Slow to dissolve. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Summary

Interleukin-13 (IL-13) is a Th2-type cytokine, secreted from CD4(+) T cells, mast cells, basophils and eosinophils. It is an immunoregulatory cytokine. It has become evident that IL-13 is a key mediator in the pathogenesis of allergic inflammation. The important role of IL-13 in the pathogenesis of bronchial asthma as well as other allergic diseases has been recognized. Additionally, IL-13 plays a major role in various other inflammatory diseases including cancer.

Related Products Docs