Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-15 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-15
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10015002 2 µg
RBG10015010 10 µg
RBG10015100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-15 is an immunomodulating cytokine that stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. IL-15 exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. Increased expression of IL-15 has been linked to with rheumatoid arthritis, inflammatory bowel disease, and diseases affiliated with retroviruses HIV and HTLV-I. Human IL-15 is biologically active on mouse cells as measured by the dose-dependent stimulation of the proliferation of mouse CTLL cells. Recombinant Human IL-15 is a 12.9 kDa protein consisting of 115 amino acid residues.

Amino Acid Sequence

MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Source

E. coli

Purity

98%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of the proliferation of CTLL-2 cells was found to be ≤ 0.5 ng/ml, corresponding to a specific activity of ≥ 2×10 6 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Summary

Interleukin-15 (IL-15) is a 14 kDa proinflammatory protein that has been shown to play a role in the activation of neutrophils, dendritic cells, and macrophages, and is essential to the development and survival of NK cells and CD8 T-cells. IL-15 activates Jak/Stat pathways by signaling through a heterotrimeric receptor. Two of the subunits of this receptor, β and γ, are shared with the IL-2 receptor, while the α subunit is unique to IL-15. Despite the expression of IL-15 mRNA in many cell types, the secreted protein is rarely detectable in biological samples. Recent research suggests that IL-15 is retained inside the cell and is only secreted in complex with its unique receptor, IL-15Rα. This chaperoning is required from the ER to Golgi through to secretion. The cytokine/receptor complex may stay bound to the cell surface, where it can be transpresented to cells expressing the βγ subunits of the receptor, or may be secreted in a soluble form that lacks the transmembrane domain of the receptor. The soluble IL-15/IL-15R complex is produced by mouse dendritic cells, fibroblasts, and macrophages, and demonstrates a 10- 100-fold increase in agonistic activity over IL-15 alone.

Related Products Docs