Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-4 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Binetrakin, Pitrakinra, B cell differentiation factor gamma, B cell growth factor, interleukin-4
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20004005 5 µg
RBG20004020 20 µg
RBG20004100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant Murine IL-4 is a 13.5 kDa globular protein containing 121 amino acid residues.

Amino Acid Sequence

MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by the dose-dependent proliferation of murine HT-2 cells is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5×105 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Summary

IL-4 (15 to 19 kDa) is produced by a variety of T cell thymocyte populations, as well as some mast cell precursors that are non-T or B cell types. Il-4 plays an important role in the activation of resting B-cells and in the subsequent proliferation and differentiation of B-cells. IL-4 is essential for IgE synthesis in vitro and its involvement with allergic diseases has been investigated. Il-4 has anti-inflammatory effects.

Related Products Docs