Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Interleukin-7 Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:IL-7, Lymphopoietin-1, pre-B-cell growth factor
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20007002 2 µg
RBG20007010 10 µg
RBG20007100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IL-7 is a hematopoietic growth factor that primarily affects early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors, such as ConA and IL-2. Human and murine IL-7 is cross-species reactive. Recombinant Murine IL-7 is a 15.0 kDa protein containing 130 amino acid residues.

Amino Acid Sequence

MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥ 5×106 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Oncology, Animal studies

Summary

Interleukin-7 (IL-7) is a pleiotropic cytokine with a variety of activities. IL-7 supports differentiation of cytotoxic T-lymphocytes and promotes the generation of lymphokine-activated killer-cells. IL-7 is further responsible for the upregulation of the production of pro-inflammatory cytokines and the stimulation of the tumoricidal activity of monocytes/macrop­hages.

Related Products Docs