Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

IP-10 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Interferon-gamma inducible Protein 10kDa, CXCL10
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10196005 5 µg
RBG10196025 25 µg
RBG10196100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant Human IP-10 is an 8.6 kDa protein consisting of 77 amino acids, including the four conserved cysteine residues present in CXC chemokines.

Amino Acid Sequence

VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10–50 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Summary

IP-10 (Interferon-gamma inducible Protein 10kDa) also known as CXCL10, is secreted by several cell types in response to IFNg and LPS. These cell types include monocytes, endothelial cells and fibroblasts.The gene for IP-10 is located on chromosome 4 in a cluster among several other cytokines and encodes a 98 amino acid precursor protein. IP-10 has been attributed to several roles, such as chemoattraction for monocytes and T cells (but not for neutrophils), inhibition of bone marrow colony formation and angiogenesis, promotion of T cells adhesion molecule expression. IP-10 shares a common receptor, CXCR3, with the chemokine MIG, but has been shown to play a distinct role in host defense in infections. IP-10 expression has been associated with HIV infection, is involved in inflammatory skin disease (6) and other allergic diseases; it appears in inflammation of the nervous system and in Alzheimer’s disease (astrocytes expressing IP-10 are commonly associated with senile plaques).

Related Products Docs