Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Kallistatin Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Serpin A4, Kallikrein inhibitor, Peptidase inhibitor 4, PI-4, SERPINA4, KST, PI4, Serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172436100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 417 AA. MW: 47.7 kDa (calculated). UniProtKB acc. No. P29622 (Gln21–Pro427). C-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKPHHHHHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

12 % SDS-PAGE separation of Human Kallistatin (HEK):
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline pH 7.4 with 5 % (w/v) Trehalose.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Immune Response, Infection and Inflammation, Oncology

Summary

Kallistatin (Kallikrein-Binding Protein – KBP, Serpin A4) is an acidic glycoprotein composed of 427 amino acids and molecular weight of 58 kDa. It belongs to the serine proteinase inhibitor (SERPIN) superfamily and is a specific endogenous inhibitor of tissue kallikrein. Tissue kallikreins are a group of serine proteinases which are best known for their ability to process plasma kininogens to generate kinins which cause vasodilation. The kallistatin protein contains two structural elements: an active site and a heparin-binding domain. The active site is crucial for complex formation with tissue kallikrein, and thus tissue kallikrein inhibition. The inhibitory activity of kallistatin is blocked upon its binding to heparin. The heparin binding domain, however, is essential for antagonizing signaling pathways mediated by vascular endothelial growth factor (VEGF), tumor necrosis factor (TNF)-α, high mobility group box-1 (HMGB1), and transforming growth factor (TGF)-β. Kallistatin is synthesized and secreted by a wide range of human tissues including kidney, liver, eye, heart, prostate, colon, blood vessels and blood cells. Kallistatin has multiple biologic functions independent of the tissue kallikrein-kinin system and exhibits pleiotropic effects in vasodilation, inhibition of inflammation, angiogenesis, fibrosis, apoptosis, oxidative stress and cancer progression. In animal models, kallistatin administration by gene or protein delivery was observed to offer protection against a large number of pathological conditions such as hypertension, cardiovascular and organ damage, arthritis, sepsis, influenza virus infection, tumor growth and metastasis and has potential for use as a therapeutic agent or target. Kallistatin levels in circulation, body fluids or tissues are significantly lower in patients with liver disease, obesity, septic syndrome, severe pneumonia, inflammatory bowel disease, and cancer of the colon and prostate. Decreased kallistatin levels were observed in vitreous fluid of patients with diabetic retinopathy, however, circulating kallistatin serum levels were shown to be elevated in type 1 diabetes patients with vascular complications. Similar results were observed in type 2 diabetic patients in which serum kallistatin is also increased and correlates with the presence of retinopathy. A recent study demonstrated that serum kallistatin levels are significantly reduced in patients with liver cirrhosis (LC) but not in hepatocellular carcinoma and this decrease correlates with the degree of LC and disruption of normal liver function.

Summary References (12)

References to Kallistatin

  • Chao J, Bledsoe G, Chao L. Kallistatin: A novel biomarker for hypertension, organ injury and cancer. Austin Biomark & Diagn. 2015;2 (2)
  • Chen VC, Chao L, Pimenta DC, Bledsoe G, Juliano L, Chao J. Identification of a major heparin-binding site in kallistatin. J Biol Chem. 2001 Jan 12;276 (2):1276-84
  • Cheng Z, Lv Y, Pang S, Bai R, Wang M, Lin S, Xu T, Spalding D, Habib N, Xu R. Kallistatin, a new and reliable biomarker for the diagnosis of liver cirrhosis. Acta Pharm Sin B. 2015 May;5 (3):194-200
  • Gao L, Li P, Zhang J, Hagiwara M, Shen B, Bledsoe G, Chang E, Chao L, Chao J. Novel role of kallistatin in vascular repair by promoting mobility, viability, and function of endothelial progenitor cells. J Am Heart Assoc. 2014 Oct;3 (5):e001194
  • Jenkins AJ, McBride JD, Januszewski AS, Karschimkus CS, Zhang B, O'Neal DN, Nelson CL, Chung JS, Harper CA, Lyons TJ, Ma JX. Increased serum kallistatin levels in type 1 diabetes patients with vascular complications. J Angiogenes Res. 2010;2:19
  • Li P, Guo Y, Bledsoe G, Yang ZR, Fan H, Chao L, Chao J. Kallistatin treatment attenuates lethality and organ injury in mouse models of established sepsis. Crit Care. 2015;19:200
  • Lin WC, Chen CW, Huang YW, Chao L, Chao J, Lin YS, Lin CF. Kallistatin protects against sepsis-related acute lung injury via inhibiting inflammation and apoptosis. Sci Rep. 2015;5:12463
  • Liu X, Zhang B, McBride JD, Zhou K, Lee K, Zhou Y, Liu Z, Ma JX. Antiangiogenic and antineuroinflammatory effects of kallistatin through interactions with the canonical Wnt pathway. Diabetes. 2013 Dec;62 (12):4228-38
  • Miao RQ, Agata J, Chao L, Chao J. Kallistatin is a new inhibitor of angiogenesis and tumor growth. Blood. 2002 Nov 1;100 (9):3245-52
  • Shen B, Hagiwara M, Yao YY, Chao L, Chao J. Salutary effect of kallistatin in salt-induced renal injury, inflammation, and fibrosis via antioxidative stress. Hypertension. 2008 May;51 (5):1358-65
  • Yin H, Gao L, Shen B, Chao L, Chao J. Kallistatin inhibits vascular inflammation by antagonizing tumor necrosis factor-alpha-induced nuclear factor kappaB activation. Hypertension. 2010 Aug;56 (2):260-7
  • Zhou GX, Chao L, Chao J. Kallistatin: a novel human tissue kallikrein inhibitor. Purification, characterization, and reactive center sequence. J Biol Chem. 1992 Dec 25;267 (36):25873-80
Related Products Docs