Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

KGF Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Keratinocyte Growth Factor, Fibroblast Growth Factor-7, HBGF-7
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10198002 2 µg
RBG10198010 10 µg
RBG10198100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

KGF/FGF-7 is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth, and the regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. KGF/FGF-7 is a mitogen factor specific for epithelial cells and keratinocytes. KGF/FGF-7 signals through FGFR 2b. KGF/FGF-7 plays a role in kidney and lung development, as well as in angiogenesis and wound healing. Recombinant Human KGF/FGF-7 is an 18.9 kDa protein consisting of 163 amino acid residues.

Amino Acid Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Source

E. coli

Purity

95%

Biological Activity

The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by KGF-responsive BaF3 cells is ≤ 10 ng/ml, corresponding to a specific activity of ≥ 1×10 5 units/mg.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in 1× PBS to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Coronary artery disease

Related Products Docs