Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

LAG-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Lymphocyte Activation Gene-1, CCL4L1, ACT-2, T-cell activiation-2, HC21
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10201005 5 µg
RBG10201020 20 µg
RBG10201100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV-suppressive factor. Recombinant Human LAG-1 is a 7.7 kDa protein containing 69 amino acid residues.

Amino Acid Sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Source

E. coli

Purity

98%

Biological Activity

Determined by it's ability to chemoattract CCR5 transfected cells using a concentration of 0.1–10.0 ng/ml

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs