Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

LD78β Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CCL3L1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10202005 5 µg
RBG10202020 20 µg
RBG10202100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

LD78β is a CC chemokine that is closely related to MIP-1α. It signals through the CCR5 receptor and the β-chemokine receptor, D6. LD78β has been shown to exhibit potent activity in HIV suppression assays. Recombinant Human LD78β is a 7.7 kDa protein containing 70 amino acid residues, including the four conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs