Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

LEC Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Liver-Expressed Chemokine, CCL16, NCC-4, HCC-4, LMC, LCC-1, MTN-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10203005 5 µg
RBG10203020 20 µg
RBG10203100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

LEC is a CC chemokine that can signal through the CCR8 and CCR1 receptors. It is expressed in the liver, spleen, and thymus. LEC is chemotactic towards monocytes and lymphocytes, but not neutrophils. Recombinant Human LEC is an 11.2 kDa protein containing 97 amino acid residues, including the four conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract total human monocytes using a concentration range of 10–100 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs