Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

LIGHT Human Hi-5 Insect cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Hi-5 Insect cells
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10206003 3 µg
RBG10206015 15 µg
RBG10206100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

LIGHT belongs to the TNF family of ligands, and can signal through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or bind to a decoy receptor, DcR3. It is expressed in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT has the ability to active NF-κB, to co-stimulate the activation of lymphocytes and to induce apoptosis in certain human tumor cells. The human LIGHT gene encodes for a 240 amino acid type II transmembrane protein containing a 37 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 182 amino acid extracellular domain. Recombinant Human LIGHT has a calculated mass of 19.3 kDa, containing 177 amino acid residues. Due to glycosylation, LIGHT migrates between 20.0–22.5 kDa by SDS-PAGE under non-reducing conditions.

Amino Acid Sequence

RLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Source

Hi-5 Insect cells

Purity

95%

Biological Activity

Determined by its cytotoxic effect on HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-ɣ.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules

Related Products Docs