Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

LIGHT Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20087005 5 µg
RBG20087020 20 µg
RBG20087100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

LIGHT belongs to the TNF family of ligands, and can signal through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or bind to a decoy receptor, DcR3. It is expressed in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT has the ability to active NF-κB, to co-stimulate the activation of lymphocytes and to induce apoptosis in certain human tumor cells. Recombinant Murine LIGHT is a 20.1 kDa protein containing 183 amino acid residues, comprising the TNF-homologous region of the LIGHT extracellular domain.

Amino Acid Sequence

MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV

Source

E. coli

Purity

98%

Biological Activity

Determined by its cytotoxic effecton HT-29 cells (human colon adenocarcinoma cells) in the presence of human IFN-γ.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Related Products Docs