Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Lungkine Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:CXCL15
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20090005 5 µg
RBG20090020 20 µg
RBG20090100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Lungkine is a CXC chemokine that is expressed in lung epithelial cells and, to a lesser extent, in certain fetal tissues. No human homolog has been identified, and a specific cell surface receptor has not yet been found. Lungkine expression in lung tissue is elevated in response to inflammation, at which time it acts to specifically recruit neutrophils and direct them into the lung airway. Recombinant Murine Lungkine is a 16.3 kDa CXC chemokine consisting of 142 amino acid residues, including four conserved cysteine residues present in CXC chemokines.

Amino Acid Sequence

QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Animal studies

Related Products Docs