Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Lymphotactin Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10208005 5 µg
RBG10208020 20 µg
RBG10208100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Lymphotactin is the only known member of the C chemokine family, and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes, but not towards monocytes or neutrophils. Recombinant Human Lymphotactin is a 10.0 kDa protein consisting of 92 amino acid residues.

Amino Acid Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human T cells using a concentration of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Related Products Docs