Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MCP-4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Monocyte Chemotactic Protein-4, CCL13, NCC-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10215005 5 µg
RBG10215020 20 µg
RBG10215100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The MCP proteins are members of the CC chemokine family that signal through CCR2 and, with the exception of MCP-1, other CCR receptors. The MCP proteins chemoattract and activate monocytes, activated Tcells, basophils, NK cells, and immature dendritic cells. The MCP family cross-reacts across species. Recombinant Human MCP-4 is an 8.6 kDa protein containing 75 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.

Amino Acid Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Neural tissue markers, Oncology

Related Products Docs