Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MDC Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage-Derived Chemokine, CCL22, STCP-1, ABCD-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10217005 5 µg
RBG10217020 20 µg
RBG10217100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells, and exerts HIV-suppressive activity. The 67 amino acid form of MDC displays reduced chemoattractant activity, but retains HIV-suppressive activity. Recombinant Human MDC is an 8.1 kDa protein containing 69 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.

Amino Acid Sequence

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human T cells using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Related Products Docs