Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MDC Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage-Derived Chemokine, CCL22, STCP-1, ABCD-1
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20095005 5 µg
RBG20095020 20 µg
RBG20095100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells, and exerts HIV-suppressive activity. The 67 amino acid form of MDC displays reduced chemoattractant activity, but retains HIV-suppressive activity. Recombinant Murine MDC is a 7.8 kDa protein containing 68 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.

Amino Acid Sequence

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human activated lymphocytes using a concentration of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Animal studies

Related Products Docs