Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MEC Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Mucosae-associated Epithelial Chemokine, CCL28, CCK-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10218005 5 µg
RBG10218020 20 µg
RBG10218100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MEC is a secreted CC chemokine expressed primarily by epithelial cells of the bronchioles, salivary gland, mammary gland and colon. MEC signals through the CCR10 receptor, and chemoattracts resting CD4, CD8T-cells and eosinophils. MEC contains six cysteines, including the four highly conserved cysteine residues present in CC chemokines. Recombinant Human MEC is a 12.3 kDa protein containing 108 amino acid residues.

Amino Acid Sequence

SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human lymphocytes using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs