Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Metalloproteinase Inhibitor 1 Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293
  • Other names:Tissue inhibitor of metalloproteinases, EPA , TAK, Metalloproteinase Inhibitor 1, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, Collagenase inhibitor, Tissue inhibitor of metalloproteinases 1 TIMP-1, TIMP1, CLGI, TIMP
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172511100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 190 AA. MW: 21.2 kDa (calculated). UniProtKB acc. No. P01033 (Cys24–Ala207). C-terminal His-tag (6 AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIAHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

12 % SDS-PAGE separation of Human Metalloproteinase Inhibitor 1:

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. Reduced and boiled sample, 2.5 μg/lane
  3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline pH7.5 + 5% (w/v) Threalose.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store lyophilized protein at –80°C. Lyophilized protein remains stable until the expiry date when stored at –80°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Others

Summary

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types and may also have an anti-apoptotic function.

Related Products
Documents