Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MIF Human Hi-5 Insect cells

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:Hi-5 Insect cells
  • Other names:GLIF, MMIF, GIF, Glycosylation-inhibiting factor, MIF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10222005 5 µg
RBG10222020 20 µg
RBG10222100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Macrophage migration inhibitory factor (MIF) is a small secreted protein that can act as a pleiotropic pro-inflammatory cytokine, as well as an enzyme. MIF pro-inflammatory activity can be initiated by signaling through CD74 and CD44, resulting in the secretion of TNF-a, IL-1, IL-6, IL-8, and various MMPs. The enzymatic activity of MIF is characterized by its ability to act as a tautomerase, capable of catalyzing the keto-to-enol isomerization of keto-phenylpyruvate and L-dopachrome. It appears as though MIF catalytic activity is dependent upon a trimeric configuration and a free N-terminal proline residue. Insect cell-derived Recombinant Human MIF is a 15 kDa protein containing 124 amino acid residues, including an N-terminal His-tag.

Amino Acid Sequence

HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Source

Hi-5 Insect cells

Purity

98%

Biological Activity

Determined by its ability to inhibit monocyte migration.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Autoimmunity, Cytokines and chemokines and related molecules, Oncology

Summary

The macrophage migration inhibitory factor (MIF) gene, located on 22q11.2, encodes a multifunctional cytokine, MIF, which is produced by several types of cells, including epithelial cells and cells that participate in the innate and adaptive immune responses. MIF is known to mediate certain cell-mediated immune responses, immune regulation, and inflammation. Overexpression and secretion of MIF help restore macrophage cytokine production and T cell activity in response to the immunosuppressive effects of glucocorticoids. Although first described as an immune cell product, a much higher MIF level was found in kinds of human cancer and cancer-prone inflammatory diseases, including chronic pancreatitis and pancreatic cancer. In addition, many functions of MIF support its potential involvement in diabetes, such as MIF inhibits INS-1 cell proliferation. MIF is a pleiotropic proinflammatory cytokine produced by many cell types such as: T lymphocytes, monocytes/macrop­hages, vascular endothelia. It is also released from the pituitary which suggests that MIF is also an endocrine factor. Because of its widespread properties it is a crucial mediator of many immune and autoimmune diseases such as: juvenile idiopathic arthritis (JIA), Crohn disease, diabetes type 1, glomerulonephritis, septic shock, inflammatory lung disease and cancer.

Summary References (3)

References to Macrophage Migration Inhibitory Factor

  • Liu YH, Chen CC, Yang CM, Chen YJ, Tsai FJ. Dual effect of a polymorphism in the macrophage migration inhibitory factor gene is associated with new-onset Graves disease in a Taiwanese Chinese population. PLoS One. 2014;9 (3):e92849
  • Swierczewska M, Ostalska-Nowicka D, Kempisty B, Szczepankiewicz A, Nowicki M. Polymorphic variants of MIF gene and prognosis in steroid therapy in children with idiopathic nephrotic syndrome. Acta Biochim Pol. 2014;61 (1):67-75
  • Tan L, Ye X, Zhou Y, Yu M, Fu Z, Chen R, Zhuang B, Zeng B, Ye H, Gao W, Lin Q, Li Z, Zhou Q, Chen R. Macrophage migration inhibitory factor is overexpressed in pancreatic cancer tissues and impairs insulin secretion function of beta-cell. J Transl Med. 2014;12:92
Related Products Docs