Type
Recombinant protein
Description
Macrophage migration inhibitory factor (MIF) is a small secreted protein that can act as a pleiotropic pro-inflammatory cytokine, as well as an enzyme. MIF pro-inflammatory activity can be initiated by signaling through CD74 and CD44, resulting in the secretion of TNF-a, IL-1, IL-6, IL-8, and various MMPs. The enzymatic activity of MIF is characterized by its ability to act as a tautomerase, capable of catalyzing the keto-to-enol isomerization of keto-phenylpyruvate and L-dopachrome. It appears as though MIF catalytic activity is dependent upon a trimeric configuration and a free N-terminal proline residue. Insect cell-derived Recombinant Human MIF is a 15 kDa protein containing 124 amino acid residues, including an N-terminal His-tag.
Amino Acid Sequence
HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Source
Hi-5 Insect cells
Purity
98%
Biological Activity
Determined by its ability to inhibit monocyte migration.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.
Storage/Expiration
–20°C