Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MIG Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Monokine Induced by Interferon-gamma, CXCL9
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20098005 5 µg
RBG20098020 20 µg
RBG20098100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MIG, a CXC chemokine, is produced by IFN-γ stimulated monocytes, macrophages and endothelial cells. It signals through the CXCR3 receptor. MIG selectively chemoattracts Th1 lymphocytes, and also exerts other activities, including inhibition of tumor growth, angiogenesis, and inhibition of colony formation of hematopoietic progenitors. Human MIG is active on murine cells. Recombinant Murine MIG is a 12.2 kDa protein containing 105 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.

Amino Acid Sequence

TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoacttract human lymphocytes using a concentration range of 0.1–1.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cardiovascular disease, Chemokines, Coronary artery disease, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation, Transplantation, Animal studies

Related Products Docs