Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MIP-3α Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage Inflammatory Protein-3α, CCL20, LARC, Exodus-1
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20103005 5 µg
RBG20103020 20 µg
RBG20103100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MIP-3α is a CC chemokine, expressed in the liver, lymph nodes, appendix, PBL and lungs that can signal through the CCR6 receptor. MIP-3α is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells, and inhibits colony formation of bone marrow myeloid immature progenitors. Recombinant Murine MIP-3α is a 7.9 kDa protein containing 70 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract murine CCR6 transfected HEK/293 cells using a concentration range of 0.1–10.0 ng/ml

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Animal studies

Related Products Docs