Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

MIP-4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage Inflammatory Protein-4, CCL18, PARC, DC-CK1, AMAC-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10229002 2 µg
RBG10229010 10 µg
RBG10229100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MIP-4 is a CC chemokine that is expressed in lymph nodes, lungs, placenta and bone marrow. MIP-4's primary receptor is unknown. MIP-4 chemoattracts lymphocytes, and has been shown to exert activity on both CD4+ and CD8+ T cells. Recombinant Human MIP-4 is a 7.8 kDa protein containing 68 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

AQVGTNKELCCLVYTSWQIPQKFLVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Source

E. coli

Purity

98%

Biological Activity

Assay #1: Determined by its ability to chemoattract human T lymphocytes using a concentration of 1.0–10.0 ng/ml. Assay #2: Determined by its ability to chemoattract human iDCs using a concentration of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs