Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

MIP-5 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Macrophage Inflammatory Protein-5, CCL15, HCC-2, Lkn-1
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10230005 5 µg
RBG10230025 25 µg
RBG10230100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

MIP-5 is a CC chemokine that is expressed in the heart, skeletal muscle and adrenal gland. MIP-5 primarily signals through the CCR1 receptor, but has also been found to bind to CCR3. MIP-5 is chemotactic towards T cells and monocytes. Recombinant Human MIP-5 is a 10.1 kDa protein containing 92 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Amino Acid Sequence

QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human T lymphocytes using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs