Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

MMP-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Matrix metalloproteinase-2, Gelatinase A, TBE-1, 72 kDa type IV collagenase, 72 kDa gelatinase, Gelatinase A, MMP-2, TBE-1, PEX, MMP2 CLG4A
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10232002 2 µg
RBG10232010 10 µg
RBG10232100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Matrix metalloproteinases (MMPs) are a family of endoproteases that require zinc and calcium for expressing catalytic activity. These enzymes play a central role in the maintenance and remodeling of the extracellular matrix. Elevated expression of their activity, caused either by up-regulation of their expression or down-regulation of their cognate inhibitors, has been implicated in various degenerative disorders, including arthritis, cardiovascular disease, skeletal growth-plate disorders, and cancer metastasis. MMP-2 is a secreted collagenase with specificity toward Type IV, V, VII, and X collagens. Recombinant Human MMP-2 is a 62.0 kDa protein containing the entire catalytic N-terminal domain and the C-terminal domain (552 amino acids).

Amino Acid Sequence

MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Source

E. coli

Purity

98%

Biological Activity

MMP-2 activity was measured by its ability to cleave a chromogenic peptide MMP-2 substrate at room temperature. At an MMP-2 concentration of 2.5 µg/ml, 50% cleavage was achieved at an incubation time of approximately 25 minutes.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.5–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease, Extracellular matrix, Oncology

Summary References (37)

References to MMP-2

  • Aschner Y, Zemans RL, Yamashita CM, Downey GP. Matrix metalloproteinases and protein tyrosine kinases: potential novel targets in acute lung injury and ARDS. Chest. 2014 Oct;146(4):1081-1091. doi: 10.1378/chest.14-0397. PMID: 25287998; PMCID: PMC4188143. See more on PubMed
  • Clark IM, Swingler TE, Sampieri CL, Edwards DR. The regulation of matrix metalloproteinases and their inhibitors. Int J Biochem Cell Biol. 2008;40(6-7):1362-78. doi: 10.1016/j.biocel.2007.12.006. Epub 2007 Dec 24. PMID: 18258475. See more on PubMed
  • Cursio R, Mari B, Louis K, Rostagno P, Saint-Paul MC, Giudicelli J, Bottero V, Anglard P, Yiotakis A, Dive V, Gugenheim J, Auberger P. Rat liver injury after normothermic ischemia is prevented by a phosphinic matrix metalloproteinase inhibitor. FASEB J. 2002 Jan;16(1):93-5. doi: 10.1096/fj.01-0279fje. Epub 2001 Nov 14. PMID: 11709491. See more on PubMed
  • Daidone MG, Silvestrini R, D'Errico A, Di Fronzo G, Benini E, Mancini AM, Garbisa S, Liotta LA, Grigioni WF. Laminin receptors, collagenase IV and prognosis in node-negative breast cancers. Int J Cancer. 1991 Jun 19;48(4):529-32. doi: 10.1002/ijc.2910480409. PMID: 1646175. See more on PubMed
  • Davidson B, Goldberg I, Gotlieb WH, Kopolovic J, Ben-Baruch G, Nesland JM, Berner A, Bryne M, Reich R. High levels of MMP-2, MMP-9, MT1-MMP and TIMP-2 mRNA correlate with poor survival in ovarian carcinoma. Clin Exp Metastasis. 1999;17(10):799-808. doi: 10.1023/a:1006723011835. PMID: 11089877. See more on PubMed
  • Davies B, Miles DW, Happerfield LC, Naylor MS, Bobrow LG, Rubens RD, Balkwill FR. Activity of type IV collagenases in benign and malignant breast disease. Br J Cancer. 1993 May;67(5):1126-31. doi: 10.1038/bjc.1993.207. PMID: 8494711; PMCID: PMC1968428. See more on PubMed
  • DeCoux A, Lindsey ML, Villarreal F, Garcia RA, Schulz R. Myocardial matrix metalloproteinase-2: inside out and upside down. J Mol Cell Cardiol. 2014 Dec;77:64-72. doi: 10.1016/j.yjmcc.2014.09.016. Epub 2014 Sep 28. PMID: 25261607; PMCID: PMC4312173. See more on PubMed
  • D'Errico A, Garbisa S, Liotta LA, Castronovo V, Stetler-Stevenson WG, Grigioni WF. Augmentation of type IV collagenase, laminin receptor, and Ki67 proliferation antigen associated with human colon, gastric, and breast carcinoma progression. Mod Pathol. 1991 Mar;4(2):239-46. PMID: 1646457. See more on PubMed
  • Ellenrieder V, Alber B, Lacher U, Hendler SF, Menke A, Boeck W, Wagner M, Wilda M, Friess H, Büchler M, Adler G, Gress TM. Role of MT-MMPs and MMP-2 in pancreatic cancer progression. Int J Cancer. 2000 Jan 1;85(1):14-20. doi: 10.1002/(sici)1097-0215(20000101)85:1<14::aid-ijc3>3.0.co;2-o. PMID: 10585576. See more on PubMed
  • Garbett EA, Reed MW, Brown NJ. Proteolysis in human breast and colorectal cancer. Br J Cancer. 1999 Sep;81(2):287-93. doi: 10.1038/sj.bjc.6690689. PMID: 10496354; PMCID: PMC2362855. See more on PubMed
  • Garbett EA, Reed MW, Stephenson TJ, Brown NJ. Proteolysis in human breast cancer. Mol Pathol. 2000 Apr;53(2):99-106. doi: 10.1136/mp.53.2.99. PMID: 10889910; PMCID: PMC1186913. See more on PubMed
  • Geervliet E, Bansal R. Matrix Metalloproteinases as Potential Biomarkers and Therapeutic Targets in Liver Diseases. Cells. 2020 May 13;9(5):1212. doi: 10.3390/cells9051212. PMID: 32414178; PMCID: PMC7290342. See more on PubMed
  • Giannelli G, Bergamini C, Marinosci F, Fransvea E, Quaranta M, Lupo L, Schiraldi O, Antonaci S. Clinical role of MMP-2/TIMP-2 imbalance in hepatocellular carcinoma. Int J Cancer. 2002 Feb 1;97(4):425-31. doi: 10.1002/ijc.1635. PMID: 11802202. See more on PubMed
  • Höyhtyä M, Fridman R, Komarek D, Porter-Jordan K, Stetler-Stevenson WG, Liotta LA, Liang CM. Immunohistochemical localization of matrix metalloproteinase 2 and its specific inhibitor TIMP-2 in neoplastic tissues with monoclonal antibodies. Int J Cancer. 1994 Feb 15;56(4):500-5. doi: 10.1002/ijc.2910560408. PMID: 8112886. See more on PubMed
  • Huang CC, Chuang JH, Chou MH, Wu CL, Chen CM, Wang CC, Chen YS, Chen CL, Tai MH. Matrilysin (MMP-7) is a major matrix metalloproteinase upregulated in biliary atresia-associated liver fibrosis. Mod Pathol. 2005 Jul;18(7):941-50. doi: 10.1038/modpathol.3800374. PMID: 15696117. See more on PubMed
  • Chen Q, Jin M, Yang F, Zhu J, Xiao Q, Zhang L. Matrix metalloproteinases: inflammatory regulators of cell behaviors in vascular formation and remodeling. Mediators Inflamm. 2013;2013:928315. doi: 10.1155/2013/928315. Epub 2013 Jun 12. PMID: 23840100; PMCID: PMC3694547. See more on PubMed
  • Iwata H, Kobayashi S, Iwase H, Masaoka A, Fujimoto N, Okada Y. Production of matrix metalloproteinases and tissue inhibitors of metalloproteinases in human breast carcinomas. Jpn J Cancer Res. 1996 Jun;87(6):602-11. doi: 10.1111/j.1349-7006.1996.tb00266.x. PMID: 8766524; PMCID: PMC5921148. See more on PubMed
  • Jäälinojä J, Herva R, Korpela M, Höyhtyä M, Turpeenniemi-Hujanen T. Matrix metalloproteinase 2 (MMP-2) immunoreactive protein is associated with poor grade and survival in brain neoplasms. J Neurooncol. 2000;46(1):81-90. doi: 10.1023/a:1006421112839. PMID: 10896208. See more on PubMed
  • Jacob-Ferreira AL, Schulz R. Activation of intracellular matrix metalloproteinase-2 by reactive oxygen-nitrogen species: Consequences and therapeutic strategies in the heart. Arch Biochem Biophys. 2013 Dec;540(1-2):82-93. doi: 10.1016/j.abb.2013.09.019. Epub 2013 Oct 5. PMID: 24103691. See more on PubMed
  • Jones JL, Glynn P, Walker RA. Expression of MMP-2 and MMP-9, their inhibitors, and the activator MT1-MMP in primary breast carcinomas. J Pathol. 1999 Oct;189(2):161-8. doi: 10.1002/(SICI)1096-9896(199910)189:2<161::AID- PATH406>3.0.CO;2-2. PMID: 10547569. See more on PubMed
  • Kodate M, Kasai T, Hashimoto H, Yasumoto K, Iwata Y, Manabe H. Expression of matrix metalloproteinase (gelatinase) in T1 adenocarcinoma of the lung. Pathol Int. 1997 Jul;47(7):461-9. doi: 10.1111/j.1440-1827.1997.tb04525.x. PMID: 9234385. See more on PubMed
  • Levy AT, Cioce V, Sobel ME, Garbisa S, Grigioni WF, Liotta LA, Stetler- Stevenson WG. Increased expression of the Mr 72,000 type IV collagenase in human colonic adenocarcinoma. Cancer Res. 1991 Jan 1;51(1):439-44. PMID: 1846313. See more on PubMed
  • Lichtinghagen R, Bahr MJ, Wehmeier M, Michels D, Haberkorn CI, Arndt B, Flemming P, Manns MP, Boeker KH. Expression and coordinated regulation of matrix metalloproteinases in chronic hepatitis C and hepatitis C virus-induced liver cirrhosis. Clin Sci (Lond). 2003 Sep;105(3):373-82. doi: 10.1042/CS20030098. PMID: 12760742. See more on PubMed
  • Liotta LA, Stetler-Stevenson WG. Metalloproteinases and cancer invasion. Semin Cancer Biol. 1990 Apr;1(2):99-106. PMID: 2103492. See more on PubMed
  • Liu HL, Li XH, Wang DY, Yang SP. Matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-1 expression in fibrotic rat liver. World J Gastroenterol. 2000 Dec;6(6):881-884. doi: 10.3748/wjg.v6.i6.881. PMID: 11819713; PMCID: PMC4728279. See more on PubMed
  • Löffek S, Schilling O, Franzke CW. Series "matrix metalloproteinases in lung health and disease": Biological role of matrix metalloproteinases: a critical balance. Eur Respir J. 2011 Jul;38(1):191-208. doi: 10.1183/09031936.00146510. Epub 2010 Dec 22. PMID: 21177845. See more on PubMed
  • Monteagudo C, Merino MJ, San-Juan J, Liotta LA, Stetler-Stevenson WG. Immunohistochemical distribution of type IV collagenase in normal, benign, and malignant breast tissue. Am J Pathol. 1990 Mar;136(3):585-92. PMID: 2156430; PMCID: PMC1877499. See more on PubMed
  • Perlikos F, Harrington KJ, Syrigos KN. Key molecular mechanisms in lung cancer invasion and metastasis: a comprehensive review. Crit Rev Oncol Hematol. 2013 Jul;87(1):1-11. doi: 10.1016/j.critrevonc.2012.12.007. Epub 2013 Jan 16. PMID: 23332547. See more on PubMed
  • Prystupa A, Boguszewska-Czubara A, Bojarska-Junak A, Toruń-Jurkowska A, Roliński J, Załuska W. Activity of MMP-2, MMP-8 and MMP-9 in serum as a marker of progression of alcoholic liver disease in people from Lublin Region, eastern Poland. Ann Agric Environ Med. 2015;22(2):325-8. doi: 10.5604/12321966.1152088. PMID: 26094532. See more on PubMed
  • Sakata K, Shigemasa K, Nagai N, Ohama K. Expression of matrix metalloproteinases (MMP-2, MMP-9, MT1-MMP) and their inhibitors (TIMP-1, TIMP-2) in common epithelial tumors of the ovary. Int J Oncol. 2000 Oct;17(4):673-81. PMID: 10995877. See more on PubMed
  • Scheau C, Badarau IA, Costache R, Caruntu C, Mihai GL, Didilescu AC, Constantin C, Neagu M. The Role of Matrix Metalloproteinases in the Epithelial- Mesenchymal Transition of Hepatocellular Carcinoma. Anal Cell Pathol (Amst). 2019 Nov 26;2019:9423907. doi: 10.1155/2019/9423907. PMID: 31886121; PMCID: PMC6899323. See more on PubMed
  • Takahara T, Furui K, Funaki J, Nakayama Y, Itoh H, Miyabayashi C, Sato H, Seiki M, Ooshima A, Watanabe A. Increased expression of matrix metalloproteinase-II in experimental liver fibrosis in rats. Hepatology. 1995 Mar;21(3):787-95. PMID: 7875677. See more on PubMed
  • Takahara T, Furui K, Yata Y, Jin B, Zhang LP, Nambu S, Sato H, Seiki M, Watanabe A. Dual expression of matrix metalloproteinase-2 and membrane-type 1-matrix metalloproteinase in fibrotic human livers. Hepatology. 1997 Dec;26(6):1521-9. doi: 10.1002/hep.510260620. PMID: 9397993. See more on PubMed
  • Takahashi Y, Kobayashi T, D'Alessandro-Gabazza CN, Toda M, Fujiwara K, Okano T, Fujimoto H, Asayama K, Takeshita A, Yasuma T, Nishihama K, Inoue R, Qin L, Takei Y, Taguchi O, Gabazza EC. Protective Role of Matrix Metalloproteinase-2 in Allergic Bronchial Asthma. Front Immunol. 2019 Aug 2;10:1795. doi: 10.3389/fimmu.2019.01795. PMID: 31428095; PMCID: PMC6687911. See more on PubMed
  • Talvensaari-Mattila A, Pääkkö P, Turpeenniemi-Hujanen T. Matrix metalloproteinase-2 (MMP-2) is associated with survival in breast carcinoma. Br J Cancer. 2003 Oct 6;89(7):1270-5. doi: 10.1038/sj.bjc.6601238. PMID: 14520459; PMCID: PMC2394290. See more on PubMed
  • Tryggvason K, Höyhtyä M, Pyke C. Type IV collagenases in invasive tumors. Breast Cancer Res Treat. 1993;24(3):209-18. doi: 10.1007/BF01833261. PMID: 8435476. See more on PubMed
  • Väisänen A, Kallioinen M, Taskinen PJ, Turpeenniemi-Hujanen T. Prognostic value of MMP-2 immunoreactive protein (72 kD type IV collagenase) in primary skin melanoma. J Pathol. 1998 Sep;186(1):51-8. doi: 10.1002/(SICI)1096-9896(199809)186:1<51::AID-PATH131>3.0.CO;2-P. PMID: 9875140. See more on PubMed
Related Products Docs