Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Monocyte Chemotactic Protein-1 Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:MCP-1, CCL2, C-C motif chemokine 2, MCAF
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30065002 2 µg
RBG30065010 10 µg
RBG30065100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

The MCP proteins are members of the CC chemokine family that signal through CCR2 and, with the exception of MCP-1, other CCR receptors. The MCP proteins chemoattract and activate monocytes, activated T cells, basophils, NK cells, and immature dendritic cells. The MCP family cross-reacts across species. Recombinant Rat MCP-1 is a 14.0 kDa protein containing 125 amino acid residues, including the four highly conserved cysteine residues present in the CC chemokines.

Amino Acid Sequence

QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human monocytes using a concentration range of 10.0–100.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Energy metabolism and body weight regulation, Animal studies

Summary

Monocyte chemotactic protein-1 (MCP-1) is a member of the C-C family of chemokines. Chemokines are mediators that share the capacity to induce directional migration of leukocytes. MCP-1 is a chemoattractant for many cell types such as monocytes, neutrophils, hepatic stellate cells, granulocytes and T lymphocytes. MCP-1 is believed to play a role in a variety of pathological conditions, including inflammatory and immune reactions, atherosclerosis and neoplasia. Monocyte Chemotactic Protein-1 (MCP-1) is also known as Monocyte Chemotactic Activating Factor (MCAF) or CCL2.

Related Products Docs