Type
Recombinant protein
Description
Nanog is a regulatory protein that is associated with undifferentiated pluripotent cells. The expression of nanog, which is suppressed in all adult tissues, is restricted to embryonic stem cells and to certain pluripotent cancer cells. Decreased expression of nanog is strongly correlated with cell differentiation. Nanog, most likely, acts as an intracellular regulator, that helps maintain pluripotency and self renewal via a STAT3-independent pathway. The introduction of nanog, along with Sox2, Oct4, and Lin28, into primary human fibroblasts was sufficient to confer a pluripotent state upon the fibroblast genome. The reprogrammed cells thus obtained resemble ESC in morphology and gene expression. Protein transduction using TAT fusion proteins represents an alternative methodology for introducing transcription factors into primary, as well as transformed, cells. Recombinant Human Nanog-TAT is a 36.1 kDa protein, which is synthesized as a 304 amino acid polypeptide plus a 13– residue C-terminal TAT peptide.
Amino Acid Sequence
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR
Source
E. coli
Purity
95%
Biological Activity
Data not available.
Endotoxin
Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Reconstitution
Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at-20°C to –80°C.
Storage/Expiration
–20°C