Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NAP-2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Neutrophil Activating Protein-2, CXCL7, PBP (parent molecule), CTAP-III (precursor)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10242002 2 µg
RBG10242010 10 µg
RBG10242100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

NAP-2 is a CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is produced in leukocytes by enzymatic processing of a precursor called platelet basic protein (PBP). NAP-2 chemoattracts and activates neutrophils. Recombinant Human NAP-2 protein is a 7.6 kDa protein containing 70 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines, and also the “ELR” motif, common to CXC chemokines that bind to CXCR1 and CXCR2.

Amino Acid Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract human neutrophils using a concentration range of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules

Related Products Docs