Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

NT-proANP Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:N-terminal proatrial natriuretic peptide
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172485100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 106 AA. MW: 11.7 kDa (calculated). UniProtKB acc. No. P01160 (Asn26–Arg123). N-terminal His-tag (8 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 95 %

SDS-PAGE Gel

14 % SDS-PAGE separation of Human NT-ANP:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/mL solution in 20 mM Tris buffer, 50 mM NaCl, 5 % w/v trehalose, pH 7.5

Reconstitution

Add 200 µL of deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Sepsis

Summary

NT-pro ANP (N-terminal proatrial natriuretic peptide) means N-terminal polypeptide of ANP (atrial natriuretic peptide) precursor. In rough microsome of atrial cells prepro ANP with 149 amino acid residues is first produced, and its signal peptide (23 amino acids) is cut off in Golgi apparatus leaving pro ANP of 126 amino acids, which is stored in secretory granules. Before secretion, N-terminal peptide of 98 amino acids (NT-pro ANP) and C-terminal peptide of 28 amino acids (ANP) are separated. ANP is secreted from the atrium with the stimulation of atrial expansion owing to the increased blood volume and/or increase in intra-atrial pressure. ANP is a ring-shaped peptide, the main targets of which are kidney and blood vessels, and causes potent natriuresis, blood vessel expansion, to lower blood pressure. ANP forms natriuretic peptide family with BNP (B-type Natriuretic peptide) and CNP (C-type Natriuretic peptide). Plasma ANP very rapidly disappears owing to binding with its receptor and so-called clearance receptor (half-life about 100seconds in canine), making its exact measurement difficult. On the other hand, NT-pro ANP, because it does not bind clearance receptor, has a long half life (60–120mins in man), and serves as an excellent marker of ANP secretion. The measurement of NT-pro ANP is expected to be useful in the examination of heart diseases in dogs

Related Products Docs