Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Neuropoietin Murine E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:NPO, NP
  • Species:Murine
Please select your region to see available products and prices.
Cat. No. Size Price


RBG20105005 5 µg
RBG20105025 25 µg
RBG20105100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Neuropoietin is a newly identified member of the IL-6 cytokine family. Members of this family, including IL-6, IL-11, oncostatin M, leukemia inhibitory factor (LIF), cardiotrophin-1 (CT-1), cardiotrophin-like cytokine, and CNTF, display a four-helix bundle structure, and signal through gp130-containing receptor complexes. Neuropoietin, which is predominantly expressed in neuroepithelia during embryonic life, acts through a receptor complex formed of a CNTF receptor-α component, gp 130, and LIF receptor. Like CNTF, it promotes the survival of embryonic motor neurons, and could increase the proliferation of neural precursor cells in the presence of EGF and FGF-2. Interestingly, the human neuropoietin gene has evolved toward a pseudogene, suggesting that alternative signaling via CNTF is an effective compensatory pathway. Recombinant Murine Neuropoietin is a 19.8 kDa protein containing 183 amino acid residues.

Amino Acid Sequence

MAPISPSEPIGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMEDAERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTALGLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA

Source

E. coli

Purity

98%

Biological Activity

The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.5–0.8 μg/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Cytokines and chemokines and related molecules, Animal studies

Related Products Docs