Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NKG2D ligand 2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:N2DL-2, NKG2DL2, ALCAN-alpha, Retinoic acid early transcript 1H, UL16-binding protein 2, ULBP2, N2DL2, RAET1H, UNQ463/PRO791
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172312100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 201 AA. MW: 22.9 kDa (calculated). UniProtKB acc.no. Q9BZM5 (Gly26-Ser216). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMS

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >90%

SDS-PAGE Gel

14% SDS-PAGE separation of Human ULBP2 :
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5μg/lane
3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/mL in 50mM Tris buffer, pH 8.6

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Summary

NKG2D ligand 2 acts as a ligand for the NKG2D receptor on the surface of NK cells. Binding of ULBPs ligands to NKG2D induces production of cytokines and chemokines. NKG2D ligand 2 is expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.. It belongs to the MHC class I family. The CMV glycoprotein UL16 interacts with NKG2D ligand 2 resulting in retention of NKG2D ligand 2 in the endoplasmic reticulum and Golgi apparatus so it does not reach the cell surface.

Related Products Docs