Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NKG2D Ligand 4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:NKG2D ligand 4, N2DL-4, NKG2DL4, Lymphocyte effector toxicity activation ligand, RAE-1-like transcript 4, RL-4, Retinoic acid early transcript 1E, RAET1E, ULBP4
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172314100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 192 AA. MW: 22 kDa (calculated). UniProtKB acc.no. Q8TD07 isoform 3. N-terminal histag (10 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTGRRST

Source

E. coli

Purity

Purity as determined by densitometric image analysis: > 85 %

SDS-PAGE Gel

14 % SDS-PAGE separation of Human NKG2D ligand 4 :
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.05M Acetate buffer pH 4.0, 1% (w/v) Sucrose, 4% (w/v) Mannitol

Reconstitution

Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/mL. In higher concentrations the solubility of this antigen is limited.Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Summary

NKG2D ligand 4 (ULBP4) acts as a ligand for the NKG2D receptor on the surface of NK cells. Its binding to the receptor induces expansion of anti-tumor cytotoxic lymphocytes. It is expressed mainly in skin, also in testes or trachea. It is up-regulated in different tumors.NKG2D ligand 4 (ULBP4) does not interacts with the CMV glycoprotein UL16.NKG2D ligand 4 (ULBP4) is expressed in two variants, as a membrane and soluble isoform.

Related Products Docs