Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NNT-1/BCSF-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Novel Neurtrophin-1/B-Cell Stimulating Factor-3, Cardiotrophin-like cytokine
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10248002 2 µg
RBG10248010 10 µg
RBG10248100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

NNT-1/BCSF-3 is a neurotrophic factor with B-cell-stimulating capabilities. Expressed in the lymph nodes and spleen, NNT-1/BCSF-3 activates glycoprotein 130 (gp130) and leukemia inhibitory factor receptor member b (LIFR-b) by binding and inducing the tyrosine phosphorylation of, these receptors. In vitro, it supports the survival of chick embryo motor and sympathetic neurons. In mice, NNT-1/BCSF-3 induces serum amyloid A, causes body weight loss, and B-cell hyperplasia associated with increases in serum IgG and IgM. Recombinant Human NNT-1/BCSF-3 is a 22.4 kDa protein containing 199 amino acid residues.

Amino Acid Sequence

MLNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Source

E. coli

Purity

98%

Biological Activity

NT-1/BCSF-3 weakly supports chick E8 DRG neurite outgrowth at a concentration of 1.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Neural tissue markers

Related Products Docs