Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NOV Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant
  • Source:HEK293
  • Other names:Nephroblastoma Overexpressed gene, CCN3, IGFBP9, NovH
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD172528100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant

Description

Total 331 AA. MW: 36.5 kDa (calculated). UniProtKB acc. No. P48745 (Gln33–Met357). C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

QRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKMHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 90 %

SDS-PAGE Gel

12 % SDS-PAGE separation of Human NOV (HEK):
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. Reduced and boiled sample, 2.5 μg/lane
3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized in phosphate buffered saline + 5 % (w/v) trehalose.

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Coronary artery disease, Oncology

Related Products Documents