Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NP-1 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Neutrophil Peptide-1, alpha Defensin-1, HNP-1, Cryptdin
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10251005 5 µg
RBG10251020 20 µg
RBG10251100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins, which include NP-1, NP-2 and NP-3, are distinguished from the β-defensins by the pairing of their three disulfide bonds. In addition to antimicrobial activity, NP-1 exhibits chemotactic activity on dendritic cells. NP-1 is expressed as the C-terminal portion of an inactive precursor protein, which also contains a 19 amino acid N-terminal signal sequence and a 45 amino acid polypeptide. NP-1 contains a six-cysteine motif that forms three intra-molecular disulfide bonds. Recombinant Human NP-1 is a 3.4 kDa protein containing 30 amino acid residues.

Amino Acid Sequence

ACYCRIPACIAGERRYGYCIYQGRLWAFCC

Source

E. coli

Purity

98%

Biological Activity

Determined by its ability to chemoattract immature dendritic cells using a concentration of 1.0–10.0 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. This solution can be stored at 2–8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Chemokines, Cytokines and chemokines and related molecules, Immune Response, Infection and Inflammation

Related Products Docs