Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NT-3 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Neurotrophin-3, Neurotrophic factor, Nerve growth factor-2, NGF-2, HGNF
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10252002 2 µg
RBG10252010 10 µg
RBG10252100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

NT-3 is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. NT-3 is expressed by neurons of the central nervous systems, and can signal through the trk receptors. NT-3 promotes the growth and survival of nerve and glial cells. The amino acid sequences of human, murine and rat NT-3 are identical. Recombinant Human NT-3 is a noncovalently linked homodimer of two 13.6 kDa polypeptide monomers (240 total amino acid residues).

Amino Acid Sequence

MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT

Source

E. coli

Purity

98%

Biological Activity

The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20–50 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Neural tissue markers

Related Products Docs