Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NT-4 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Neurotrophin-4, Neurotrophic 4/5 (NT-4/NT-5)
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RBG10253002 2 µg
RBG10253010 10 µg
RBG10253100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

NT-4 is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-3. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. NT-4 is expressed in the prostate, thymus, placenta, and skeletal muscle. NT-4 can signal through the LNGFR and trkB receptors, and promotes the survival of peripheral sensory sympathetic neurons. Recombinant Human NT-4 is a noncovalently linked homodimer of two 14.0 kDa polypeptide monomers (260 total amino acid residues).

Amino Acid Sequence

GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

Source

E. coli

Purity

98%

Biological Activity

Determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20–50 ng/ml.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C.

Storage/Expiration

 –20°C

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers

Related Products Docs