Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

NT-proBNP Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:N-terminal Prohormone of Brain Natriuretic Peptide
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


New RD175486100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 82 AA. MW: 9.3 kDa (calculated). UniProtKB acc. no. P16860 (His27–Arg102). C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human NT-proBNP (HEK):

  1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
  2. Reduced and boiled sample, 2.5 μg/lane
  3. Non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 0.1 EU/μg

Formulation

Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in phosphate buffered saline, pH7.5.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Cardiovascular disease, Diabetology - Other Relevant Products, Renal disease

Summary References (2)

References to NT-proBNP

  • Atisha D, Bhalla MA, Morrison LK, Felicio L, Clopton P, Gardetto N, Kazanegra R, Chiu A, Maisel AS. A prospective study in search of an optimal B-natriuretic peptide level to screen patients for cardiac dysfunction. Am Heart J. 2004 Sep;148 (3):518-23
  • Bhalla V, Willis S, Maisel AS. B-type natriuretic peptide: the level and the drug--partners in the diagnosis of congestive heart failure. Congest Heart Fail. 2004 Jan-Feb;10 (1 Suppl 1):3-27
Related Products Docs