Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Oncostatin M Rat E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:OSM
  • Species:Rat
Please select your region to see available products and prices.
Cat. No. Size Price


RBG30068002 2 µg
RBG30068010 10 µg
RBG30068100 100 μg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposi’s sarcoma cells, OSM can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi’s sarcoma cells, but inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptors in hepatoma cells. OSM shares several structural and functional characteristics with LIF, IL-6, and CNTF. Recombinant Rat Oncostatin M is a 24.4 kDa protein, containing 215 amino acid residues.

Amino Acid Sequence

MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR

Source

E. coli

Purity

98%

Biological Activity

Assay #1: Determined by its ability to stimulate the proliferation of rat C6 cells. The expected ED50 is 3.0–5.0 µg/ml. Assay #2: Determined by its ability to inhibit Alkaline phosphatase activity of differentiated MC3T3 E1 cells.

Storage/Expiration

 –20°C

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Coronary artery disease, Immune Response, Infection and Inflammation, Animal studies

Related Products Docs